PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8563_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 254aa    MW: 28762.3 Da    PI: 9.7663
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8563_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-2092151357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  RrC8563_p1  92 TRWNPTQEQIGILEILYKGgMRTPNAQQIEHITSQLgkygKIEGKNVFYWFQNHKARERQ 151
                 7*****************99**************************************97 PP

2Wus_type_Homeobox114.93.9e-3792153465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQi iLe lyk G+rtPn+++i++it++L +yGkie+kNVfyWFQN+kaRerqkq
         RrC8563_p1  92 TRWNPTQEQIGILEILYKGGMRTPNAQQIEHITSQLGKYGKIEGKNVFYWFQNHKARERQKQ 153
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.73487152IPR001356Homeobox domain
SuperFamilySSF466895.56E-1288156IPR009057Homeodomain-like
SMARTSM003897.1E-789156IPR001356Homeobox domain
PfamPF000464.7E-1892151IPR001356Homeobox domain
CDDcd000867.72E-592153No hitNo description
Gene3DG3DSA:1.10.10.601.9E-793151IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MKVHEFSNGF SSWEQQESPS SLSLSCKRFR PLAPKLSVSP SSPPSSSSGV TSATFDLKSF  60
IKPDQEADPT KSDYSLEHKR DFSQVEMHPG GTRWNPTQEQ IGILEILYKG GMRTPNAQQI  120
EHITSQLGKY GKIEGKNVFY WFQNHKARER QKQKRNNLIS LGCQGSLSTT NVSNASVTMK  180
TRTSSSPDLK RESLVMKELV EENEYKRTCR SWGFENLKIE NRRNINSSIN ATVATTFNID  240
NVTLELFPLH PEGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009145045.11e-161PREDICTED: WUSCHEL-related homeobox 4-like
SwissprotQ6X7J91e-129WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A078I3Z81e-161A0A078I3Z8_BRANA; BnaA05g18600D protein
TrEMBLM4ETT01e-161M4ETT0_BRARP; Uncharacterized protein
STRINGBra032212.1-P1e-160(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59802747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.11e-114WUSCHEL related homeobox 4